PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_05643_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 593aa    MW: 67037.8 Da    PI: 7.0179
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_05643_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix91.58.7e-29409492185
                    trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfd 83 
                                 rW+  ev aLi++r ++e+++r+  lk+p We+vs+ m++ g++rs+++Ckekwen+nk+++k ke+ kkr s++s+tc+yfd
  Cotton_A_05643_BGI-A2_v1.0 409 RWPIAEVEALIQVRCDLESKFREPGLKGPVWEQVSSLMSSFGYQRSAQKCKEKWENINKYFRKSKESGKKR-SQKSKTCSYFD 490
                                 8*********************************************************************8.89999****** PP

                    trihelix  84 ql 85 
                                 ql
  Cotton_A_05643_BGI-A2_v1.0 491 QL 492
                                 *9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122037.52E-24408473No hitNo description
PROSITE profilePS500906.249409466IPR017877Myb-like domain
PfamPF138371.9E-20409494No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MHPIKYGAHH HHHHHHHLQQ QQFMEDDDAS SSASIFFISN PHNHQQQPVF PYPSQQHNKQ  60
HENPVTHQLF HHQFQPFQHP EPVHHHSQQQ QQPFLAVNFK LGLNENSGKK EAALPLNHQQ  120
NGATFLHGNE QQQQHSLFLP RCLPPQEDFP IKEPFWKPLN RCDDRQCSAD GAKMIEGTKY  180
NKVLQQPGQS TSERSRNLDS KYGLFGELEA IYGLGKRGEA AQAGSGSALT GENSPANVGP  240
SMNLTKFQEH DVVGANGGGG NVVATGVDHG SEASIGKEAS LRKVQKKKRK MKMKEQLSSM  300
VVFFESLVKQ VTDHQECLHK RFLQFIERME KERSVKEESW RQQEAEKHNR EAVARAHEQA  360
LASSREALIV SYLEKITGES INLPGKTPLQ QPGNAMEPFN GVKVDNSIRW PIAEVEALIQ  420
VRCDLESKFR EPGLKGPVWE QVSSLMSSFG YQRSAQKCKE KWENINKYFR KSKESGKKRS  480
QKSKTCSYFD QLGQLYSRIP ITCPTSPTPL INNDIEVQKQ GDSDFLEAYL PERDLVTAQV  540
NISGNLKDSE MNIPKLDFDG IVGENVAEGS KVKYNESHES ELDGDDNDSD KGE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1280289LRKVQKKKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBMTransfer from LOC_Os02g01380Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487856.10.0PREDICTED: trihelix transcription factor GTL1-like
TrEMBLA0A0D2N4K80.0A0A0D2N4K8_G
STRINGPOPTR_0018s05520.11e-147(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16469813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.26e-47Trihelix family protein